Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowerinsectstropicalmeadow
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Orange Honeysuckle from Celebrating wildflowers coloring book
Ladybug from Ladybug
Ladybug from Ladybug
Ragged Robin or Deerhorn Clarkia from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Bee from Cartoon animals coloring book
Lavender from Plants ii coloring book
Bumblebee from Woodland animals
Butterfly from Cartoon animals viii coloring book
Daffodil from Daffodil
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Apple Blossom Branch from Apple tree
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Swallow Tail Hummingbird from Hummingbirds
Steampunk Bee from Steampunk animals coloring book
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Spring Crocus from Crocus
Chinese Peony from Flowers
Butterfly from Cartoon animals vii coloring book
Bug from Animals
Hibiscus from Realistic flowers
Hibiscus Flower from Hawaii flower
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Orchid Lycaste Aromatica from Orchid
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Disa Kewensis Orchid from Orchid
Iris Motif from Iris
Pollinators of Alaska from Nps
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Double Delight Hybrid Tea Rose from Roses
Black Elderberry from Elderberry
Chrysanthemum 1 from Perennial
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Schlumbergera Bloom from Cactus
Clarkia Amoena Farewell to Spring from Godetia
Daffodil Flowers from Daffodil
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Oriental poppy from Perennial
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals viii coloring book
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Bumblebee from Simple objects coloring book
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Hummingbird from Cartoon animals ii coloring book
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Cornflower, Blue Bottle from Cornflowers
Ranunculus Acris from Buttercup
Butterfly Flies On A Flower from Flowers
Scarlet Carnation from Carnation
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Life Cycle of Monarch Butterfly from Biology
Pink Hibiscus from Realistic flowers
Big-Headed Clover from Celebrating wildflowers coloring book
Daffodil from Daffodil
Blooming Sunflower from Sunflower
Chrysanthemum Morifolium from Flower garden
Anemone Coronaria from Anemone
Yellow Edged Giant Owl Butterfly from Butterfly
Chrysanthemum Carinatum from Realistic flowers
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Grasshopper in Garden from Grasshoppers
Grasshopper on Flower from Grasshoppers
Sophronitis Cernua Orchid from Orchid
Aster 1 from Asters
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Bug from Cartoon animals coloring book
201 - 300 of 1,830 Next page
/ 19