Doodle

1,867 Printables of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardensinsectswildflowernaturetropical
Ragged Robin or Deerhorn Clarkia from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Bee-Shaped Writing Template from Insects
Cute Bee Printable Stickers from Printable stickers
Shape of Monarch Butterfly from Animals
Shape of Butterfly Moth from Animals
Bee from Cartoon animals coloring book
Lavender from Plants ii coloring book
Chrysanthemum Indiana from Realistic flowers
Anemone Transsilvanica from Anemone
Ladybug from Ladybug
Daizy from Plants iii coloring book
Anemone from Anemone
Marigold from Marigolds
American Redstart Birds and Honeycomb from Animals
Chrysanthemum 3 from Perennial
Dendrobium Nobile Orchid from Orchid
Solidago or Goldenrod from Goldenrod
Charisma Yellow Red Floribunda Rose from Roses
Chrysanthemum 4 from Perennial
Duchesse de Brabant Rose Bush from Roses
Golden Showers Climbing Rose from Roses
Orchid Lycaste Aromatica from Orchid
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Disa Kewensis Orchid from Orchid
Iris Motif from Iris
Pollinators of Alaska from Nps
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Double Delight Hybrid Tea Rose from Roses
Black Elderberry from Elderberry
Chrysanthemum 1 from Perennial
Black Orchid from Orchid
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Caterpillar and Buttefly from Caterpillar
Orchids from Orchid
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Shape of Monarch Butterfly from Animals
Bumblebee from Woodland animals
Butterfly from Cartoon animals viii coloring book
Daffodil from Daffodil
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Apple Blossom Branch from Apple tree
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Swallow Tail Hummingbird from Hummingbirds
Steampunk Bee from Steampunk animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals viii coloring book
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Bumblebee from Simple objects coloring book
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Hummingbird from Cartoon animals ii coloring book
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Spring Crocus from Crocus
Chinese Peony from Flowers
Butterfly from Cartoon animals vii coloring book
Bug from Animals
Hibiscus from Realistic flowers
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Hibiscus Flower from Hawaii flower
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Grasshopper in Garden from Grasshoppers
Grasshopper on Flower from Grasshoppers
Sophronitis Cernua Orchid from Orchid
Aster 1 from Asters
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Schlumbergera Bloom from Cactus
Clarkia Amoena Farewell to Spring from Godetia
Daffodil Flowers from Daffodil
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Oriental poppy from Perennial
301 - 400 of 1,867 Next page
/ 19